PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G065900.1
Common NamePHAVU_007G065900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family TCP
Protein Properties Length: 325aa    MW: 34315.4 Da    PI: 6.1704
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G065900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP118.58e-37641602101
                 TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaak 92 
                         +++k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti WLl+ a+pai+e+tgt++ +a ++ ++    +  +ss+++   
  Phvul.007G065900.1  64 TVAKRPSKDRHTKVEGRGRRIRMPATCAARIFQLTRELGHKSDGETIRWLLEHAEPAIIEATGTGTVPAIAV-SVGGTLKIPTSSAARPDG 153
                         5789************************************************************88888554.122222222222222222 PP

                 TCP  93 saakskksq 101
                         +++   k++
  Phvul.007G065900.1 154 EET--PKKR 160
                         222..1111 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.3E-2970154IPR005333Transcription factor, TCP
PROSITE profilePS5136927.51270124IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0031347Biological Processregulation of defense response
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MESNPTHDGD DTSEKLSPPM VEPTESSSPC LSPSQALQMK EEAMDVEQGV DVSLPMNVIP  60
MPLTVAKRPS KDRHTKVEGR GRRIRMPATC AARIFQLTRE LGHKSDGETI RWLLEHAEPA  120
IIEATGTGTV PAIAVSVGGT LKIPTSSAAR PDGEETPKKR RRRASNSEFI DVNENHVSVS  180
SGLAPIAQTA YGGVASGGGV VPLWNGNASG PFFMFPNASN PPQYWAIPAT AAPFFNVQAR  240
PISGFVSALQ MHEQDRHSSD GGASDSVNSS STVGSSMSSV SVTTAVASSS SAATTTQILR  300
DFSLEIYDKK ELQFLGQAPP SSKP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157162KKRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00064PBMTransfer from AT5G51910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143360.10.0hypothetical protein PHAVU_007G065900g
SwissprotQ9LT894e-78TCP19_ARATH; Transcription factor TCP19
TrEMBLV7BC020.0V7BC02_PHAVU; Uncharacterized protein
STRINGGLYMA20G29330.21e-168(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.22e-72TCP family protein